DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15456 and selenow2b

DIOPT Version :9

Sequence 1:NP_001285491.1 Gene:CG15456 / 50123 FlyBaseID:FBgn0040650 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_919399.3 Gene:selenow2b / 378438 ZFINID:ZDB-GENE-030428-2 Length:94 Species:Danio rerio


Alignment Length:95 Identity:34/95 - (35%)
Similarity:55/95 - (57%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQH 65
            :|||::||||...:..:...|:..:..:.||.::|...||||.||:.|:..||.|||....||..
Zfish     2 VVKVKIEYCGAUGYEPRFQELKREICGNCPDAEVSGFVGRRGCFEIQINDFLVFSKLESGGFPYS 66

  Fly    66 ASVLAQVQKAERGEPVEKVLEQPIKDCVVM 95
            ..::..|.||:.|:| ||:.... |:|:::
Zfish    67 EDIIEAVVKAKDGKP-EKITRNR-KECIIL 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15456NP_001285491.1 CXXU_selWTH 4..74 CDD:274013 24/69 (35%)
selenow2bNP_919399.3 CXXU_selWTH 5..75 CDD:274013 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576467
Domainoid 1 1.000 58 1.000 Domainoid score I10754
eggNOG 1 0.900 - - E1_2CYC3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5242
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1615913at2759
OrthoFinder 1 1.000 - - FOG0006228
OrthoInspector 1 1.000 - - otm26263
orthoMCL 1 0.900 - - OOG6_107930
Panther 1 1.100 - - O PTHR15124
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.760

Return to query results.
Submit another query.