DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15456 and Selenov

DIOPT Version :10

Sequence 1:NP_652292.1 Gene:CG15456 / 50123 FlyBaseID:FBgn0040650 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_778198.2 Gene:Selenov / 280621 MGIID:3608324 Length:328 Species:Mus musculus


Alignment Length:58 Identity:19/58 - (32%)
Similarity:32/58 - (55%) Gaps:3/58 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKVEVEYCGICNFSGQCHLLREFLLASSPDL---DISCRTGRRGSFEVSIDGQLVHSK 56
            :.:.|.|||: ::..:..:|:..|....|:|   :....|...|.|||.:||:|:|||
Mouse   245 ILIRVMYCGLUSYGLRYIILKRTLEHQFPNLLEFEEERATQVTGEFEVFVDGKLIHSK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15456NP_652292.1 CXXU_selWTH 4..74 CDD:274013 19/56 (34%)
SelenovNP_778198.2 PHA03247 <2..242 CDD:223021
CXXU_selWTH 247..320 CDD:274013 19/56 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.