DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15456 and Mien1

DIOPT Version :9

Sequence 1:NP_001285491.1 Gene:CG15456 / 50123 FlyBaseID:FBgn0040650 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_079835.1 Gene:Mien1 / 103742 MGIID:1913678 Length:115 Species:Mus musculus


Alignment Length:95 Identity:35/95 - (36%)
Similarity:51/95 - (53%) Gaps:3/95 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKVEVEYCGICNFSGQCHLLREFLLASSPDLDISCRTGRRGSFEVSIDGQLVHSKLSCLAFPQHA 66
            |.:.||||..|.|......|...:....|.::|..|.|..|:||:.|:||||.|||....||...
Mouse    23 VHIVVEYCKPCGFEATYLELASAVKEEYPGIEIESRLGGTGAFEIEINGQLVFSKLENGGFPYEK 87

  Fly    67 SVLAQVQKAERGEPVEKVL-EQPIKDCVVM 95
            .::..:::|..||||||:. .:|  .||::
Mouse    88 DLMEAIRRASNGEPVEKITNSRP--PCVIL 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15456NP_001285491.1 CXXU_selWTH 4..74 CDD:274013 24/69 (35%)
Mien1NP_079835.1 CXXU_selWTH 25..95 CDD:274013 24/69 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833742
Domainoid 1 1.000 47 1.000 Domainoid score I12005
eggNOG 1 0.900 - - E1_2CYC3
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5369
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006228
OrthoInspector 1 1.000 - - oto94208
orthoMCL 1 0.900 - - OOG6_107930
Panther 1 1.100 - - LDO PTHR15124
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5601
SonicParanoid 1 1.000 - - X4502
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.