powered by:
Protein Alignment CG15461 and CG34200
DIOPT Version :9
Sequence 1: | NP_652291.1 |
Gene: | CG15461 / 50122 |
FlyBaseID: | FBgn0040649 |
Length: | 58 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097193.1 |
Gene: | CG34200 / 5740389 |
FlyBaseID: | FBgn0085229 |
Length: | 52 |
Species: | Drosophila melanogaster |
Alignment Length: | 55 |
Identity: | 21/55 - (38%) |
Similarity: | 33/55 - (60%) |
Gaps: | 7/55 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MVEKTKTLQLLLMARAVLTIIYNDHFCWTFIKSYGLFSLAIPLAKYFDGFQVLPT 55
||:.:..| :::..|||:.|.|..:||||||.|.:.|||.|.|.:::|:
Fly 1 MVKSSNPL-------SIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPS 48
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45441208 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.