DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15461 and CG34200

DIOPT Version :10

Sequence 1:NP_652291.1 Gene:CG15461 / 50122 FlyBaseID:FBgn0040649 Length:58 Species:Drosophila melanogaster
Sequence 2:NP_001097193.1 Gene:CG34200 / 5740389 FlyBaseID:FBgn0085229 Length:52 Species:Drosophila melanogaster


Alignment Length:55 Identity:21/55 - (38%)
Similarity:33/55 - (60%) Gaps:7/55 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVEKTKTLQLLLMARAVLTIIYNDHFCWTFIKSYGLFSLAIPLAKYFDGFQVLPT 55
            ||:.:..|       :::..|||:.|.|..:||||||.|.:.|||.|.|.:::|:
  Fly     1 MVKSSNPL-------SIVRSIYNNEFQWMLVKSYGLFFLGVRLAKEFVGVELMPS 48

Return to query results.
Submit another query.