DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11458 and AT1G02710

DIOPT Version :9

Sequence 1:NP_652283.1 Gene:CG11458 / 50110 FlyBaseID:FBgn0040637 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_171771.1 Gene:AT1G02710 / 839483 AraportID:AT1G02710 Length:96 Species:Arabidopsis thaliana


Alignment Length:97 Identity:50/97 - (51%)
Similarity:57/97 - (58%) Gaps:12/97 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ALLAVLLIGVIFAFVS---AGGGGGGGGGQGGWQKNGGGGGGGGQGGWQKGGGGGGGGKHGGGGG 65
            |..||::||.:..|.:   ..||.|||.|:|.|...|||.||||:||   ||.||||.|...|||
plant     9 ASAAVIMIGGLGLFGTHSLQAGGNGGGSGKGQWLHGGGGEGGGGEGG---GGEGGGGQKISKGGG 70

  Fly    66 GGGKHGGGNGGGGKHGGGGGGGGGGGKHGGGG 97
            |||      .|||:....|||||||...||||
plant    71 GGG------SGGGQRSSSGGGGGGGEGDGGGG 96



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.