DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4186 and Chchd7

DIOPT Version :9

Sequence 1:NP_001287132.1 Gene:CG4186 / 50107 FlyBaseID:FBgn0040634 Length:85 Species:Drosophila melanogaster
Sequence 2:XP_003749940.1 Gene:Chchd7 / 684258 RGDID:1592689 Length:85 Species:Rattus norvegicus


Alignment Length:69 Identity:31/69 - (44%)
Similarity:43/69 - (62%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 NPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNKVKTERRAKGIAPYLPPLEERDGIKA 75
            ||||.|.:.|.:|:::||:||::|..||..|.||:.|||.|..:||..|:.|.:|...|||.|..
  Rat    14 NPCLSESDASTRCMDENNYDRERCSSYFLKYKNCRRFWNSVMIQRRQNGVQPSMPTAAERDEILG 78

  Fly    76 EYMK 79
            ...|
  Rat    79 AMQK 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4186NP_001287132.1 Cyt_c_Oxidase_VIb 2..57 CDD:295481 22/45 (49%)
Chchd7XP_003749940.1 Cyt_c_Oxidase_VIb 14..64 CDD:383131 24/49 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 79 1.000 Domainoid score I8450
eggNOG 1 0.900 - - E1_KOG4618
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I5125
OMA 1 1.010 - - QHG47112
OrthoDB 1 1.010 - - D1617584at2759
OrthoFinder 1 1.000 - - FOG0006536
OrthoInspector 1 1.000 - - oto98699
orthoMCL 1 0.900 - - OOG6_106193
Panther 1 1.100 - - LDO PTHR46811
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.840

Return to query results.
Submit another query.