DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4186 and chchd7

DIOPT Version :9

Sequence 1:NP_001287132.1 Gene:CG4186 / 50107 FlyBaseID:FBgn0040634 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001120658.2 Gene:chchd7 / 561510 ZFINID:ZDB-GENE-080204-55 Length:88 Species:Danio rerio


Alignment Length:78 Identity:29/78 - (37%)
Similarity:49/78 - (62%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QNAEQDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNKVKTERRAKGIAPYLPPLEE 69
            :||: .|||::|.:.|.:||:..|:|::.|..||..|.:|:::|:.|..:|:..|:.|.:|..||
Zfish    12 RNAD-SNPCIEESDNSQRCLDAYNYDKNMCSAYFMKYKSCRKYWHDVMLQRKRSGVKPEMPNAEE 75

  Fly    70 RDGIKAEYMKGKP 82
            |..|... :.|||
Zfish    76 RQQILTA-LGGKP 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4186NP_001287132.1 Cyt_c_Oxidase_VIb 2..57 CDD:295481 19/51 (37%)
chchd7NP_001120658.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 67 1.000 Domainoid score I9760
eggNOG 1 0.900 - - E1_KOG4618
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I5339
OMA 1 1.010 - - QHG47112
OrthoDB 1 1.010 - - D1617584at2759
OrthoFinder 1 1.000 - - FOG0006536
OrthoInspector 1 1.000 - - oto40573
orthoMCL 1 0.900 - - OOG6_106193
Panther 1 1.100 - - LDO PTHR46811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1312.870

Return to query results.
Submit another query.