DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4186 and chchd7

DIOPT Version :9

Sequence 1:NP_001287132.1 Gene:CG4186 / 50107 FlyBaseID:FBgn0040634 Length:85 Species:Drosophila melanogaster
Sequence 2:NP_001017090.1 Gene:chchd7 / 549844 XenbaseID:XB-GENE-1001357 Length:85 Species:Xenopus tropicalis


Alignment Length:84 Identity:36/84 - (42%)
Similarity:49/84 - (58%) Gaps:3/84 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPRNQNAE--QDNPCLKEQELSFKCLNKNNFDRDKCEIYFANYNNCKEFWNKVKTERRAKGIAPY 63
            |.||:...  ..||||:|.:.|.||::.|.:::|.|..||..|.||::|||.:...||.:|..||
 Frog     2 MSRNRRMRDLDSNPCLEETDASTKCMDDNRYEKDLCTPYFVKYKNCRKFWNGIMVTRRREGTVPY 66

  Fly    64 LPPLEERDGIKAEYMKGKP 82
            :|..|||..| .|.||..|
 Frog    67 MPTAEERKHI-LESMKSLP 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4186NP_001287132.1 Cyt_c_Oxidase_VIb 2..57 CDD:295481 22/56 (39%)
chchd7NP_001017090.1 CHCH 16..49 CDD:399611 14/32 (44%)
Cx9C motif 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 16..26 4/9 (44%)
Cx9C motif 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU01150 37..47 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 78 1.000 Inparanoid score I5076
OMA 1 1.010 - - QHG47112
OrthoDB 1 1.010 - - D1617584at2759
OrthoFinder 1 1.000 - - FOG0006536
OrthoInspector 1 1.000 - - oto105396
Panther 1 1.100 - - LDO PTHR46811
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10880
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.110

Return to query results.
Submit another query.