DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ACA7

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_172287.1 Gene:ACA7 / 837326 AraportID:AT1G08080 Length:275 Species:Arabidopsis thaliana


Alignment Length:302 Identity:81/302 - (26%)
Similarity:124/302 - (41%) Gaps:72/302 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAFHKLLLLLPLAFYQSTNG-----MEWNYLKNGK-----------DWEDLCSSGKHQSPI-LLD 51
            :|...:..::.::...|::|     .|:||.||.:           :|| :|..|:.|||| |::
plant    13 VALFSIFTIVSISSAASSHGEVEDEREFNYKKNDEKGPERWGELKPEWE-MCGKGEMQSPIDLMN 76

  Fly    52 SRTARKWVLPGITFWHYYRLLKRPF-----YIRNNGHSISLDIPVTSNGRKPFITGG---RLKG- 107
            .|         :....:...|.|.:     .::|.||.|.|          .|..|.   ::.| 
plant    77 ER---------VNIVSHLGRLNRDYNPSNATLKNRGHDIML----------KFEDGAGTIKINGF 122

  Fly   108 RYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVR 172
            .|....||:|      ..|||.||.|||..|:|:||.....|           :|||.::..|.|
plant   123 EYELQQLHWH------SPSEHTINGRRFALELHMVHEGRNRR-----------MAVVTVLYKIGR 170

  Fly   173 KDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWI 237
            .|....: |.:.:|.:..:...:.|..:...:.:.     :..|.::.|.||||||.|.:.|||.
plant   171 ADTFIRS-LEKELEGIAEMEEAEKNVGMIDPTKIK-----IGSRKYYRYTGSLTTPPCTQNVTWS 229

  Fly   238 VFTETTTVTMSSVSKFWLLRDHWGHRLINNYRIVQDLNNRTV 279
            |..:..|||...|.   |||........:|.|.||..|.|.|
plant   230 VVRKVRTVTRKQVK---LLRVAVHDDANSNARPVQPTNKRIV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 75/272 (28%)
ACA7NP_172287.1 alpha_CA_prokaryotic_like 49..270 CDD:239398 73/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.