DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ACA5

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_172285.2 Gene:ACA5 / 837324 AraportID:AT1G08065 Length:277 Species:Arabidopsis thaliana


Alignment Length:284 Identity:73/284 - (25%)
Similarity:112/284 - (39%) Gaps:81/284 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EWNYLKNGK-----------DWEDLCSSGKHQSPI-LLDSRTARKWVLPGITFWHYYRLLKRPFY 77
            ::||.|.|:           :|. :|..|..|||| |.|.|         :...|....|:..:.
plant    34 QFNYEKKGEKGPENWGRLKPEWA-MCGKGNMQSPIDLTDKR---------VLIDHNLGYLRSQYL 88

  Fly    78 -----IRNNGHSISL-------DIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLI 130
                 |:|.||.|.:       .:.:|.||.:           |....:|:|      ..|||.:
plant    89 PSNATIKNRGHDIMMKFEGGNAGLGITINGTE-----------YKLQQIHWH------SPSEHTL 136

  Fly   131 NKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVP--- 192
            |.:||..|.|:||:::..||           ||||....:.:.|....| |.|.::.:....   
plant   137 NGKRFVLEEHMVHQSKDGRN-----------AVVAFFYKLGKPDYFLLT-LERYLKRITDTHESQ 189

  Fly   193 --IEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWL 255
              :|..:...||..|          :.::.:.||||||.|.|.|.|.:..|..|||:..:.   :
plant   190 EFVEMVHPRTFGFES----------KHYYRFIGSLTTPPCSENVIWTISKEMRTVTLKQLI---M 241

  Fly   256 LRDHWGHRLINNYRIVQDLNNRTV 279
            ||.....:..:|.|.:|..|.|.|
plant   242 LRVTVHDQSNSNARPLQRKNERPV 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 71/280 (25%)
ACA5NP_172285.2 PLN02179 9..231 CDD:177835 61/245 (25%)
alpha_CA_prokaryotic_like 44..265 CDD:239398 68/272 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.