DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ACA6

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_193832.1 Gene:ACA6 / 827847 AraportID:AT4G21000 Length:260 Species:Arabidopsis thaliana


Alignment Length:248 Identity:69/248 - (27%)
Similarity:99/248 - (39%) Gaps:82/248 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PLAFY-QST--NGMEWNYLKNGKDWEDLCSSGKHQSPI-LLDSRTARKWVLPGITFWHYYRLLK- 73
            ||..| |.|  ...||.  |....|: :||:||.|||| |.|.|         ::..|...|.| 
plant    35 PLFTYKQKTEKGPAEWG--KLDPQWK-VCSTGKIQSPIDLTDER---------VSLIHDQALSKH 87

  Fly    74 -RP--FYIRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLH--------FHWGSYKSRGSE 127
             :|  ..|::.||    |:.|:..|     .||::.       :|        .||.|    .||
plant    88 YKPASAVIQSRGH----DVMVSWKG-----DGGKIT-------IHQTDYKLVQCHWHS----PSE 132

  Fly   128 HLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVP 192
            |.||...:|.|:|:||.:...:.           .||.::..:...|..    |::::..:..| 
plant   133 HTINGTSYDLELHMVHTSASGKT-----------TVVGVLYKLGEPDEF----LTKILNGIKGV- 181

  Fly   193 IEDSNATVFGQSSLDQLIGGVSHRD-------FFTYEGSLTTPLCDETVTWIV 238
                     |:..:|  :|.|..||       |:.|.||||.|.|.|.|.|.|
plant   182 ---------GKKEID--LGIVDPRDIRFETNNFYRYIGSLTIPPCTEGVIWTV 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 63/233 (27%)
ACA6NP_193832.1 PLN02179 1..235 CDD:177835 69/248 (28%)
alpha_CA_prokaryotic_like 46..225 CDD:239398 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.