DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ACA4

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_193831.1 Gene:ACA4 / 827846 AraportID:AT4G20990 Length:267 Species:Arabidopsis thaliana


Alignment Length:278 Identity:74/278 - (26%)
Similarity:116/278 - (41%) Gaps:60/278 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 PLAFYQST-NGME-WNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPF 76
            |..:.|.| .|.| |.  |....|: :|::|::||||  |....|..::....:...|:  ..|.
plant    35 PFTYEQKTEKGPEGWG--KINPHWK-VCNTGRYQSPI--DLTNERVSLIHDQAWTRQYK--PAPA 92

  Fly    77 YIRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGL-HFHWGSYKSRGSEHLINKRRFDAEIH 140
            .|.|.||    ||.|:..|     ..|::..|.....| ..||.|    .|||.:|..|:|.|:|
plant    93 VITNRGH----DIMVSWKG-----DAGKMTIRKTDFNLVQCHWHS----PSEHTVNGTRYDLELH 144

  Fly   141 IVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSS 205
            :||.:.:.|.           ||:.::..:...:..    |::|:..:..|..::.|        
plant   145 MVHTSARGRT-----------AVIGVLYKLGEPNEF----LTKLLNGIKAVGNKEIN-------- 186

  Fly   206 LDQLIGGVSHRD-------FFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHR 263
                :|.:..|:       |:.|.||||.|.|.|.|.|.|.....|::|..::   .||......
plant   187 ----LGMIDPREIRFQTRKFYRYIGSLTVPPCTEGVIWTVVKRVNTISMEQIT---ALRQAVDDG 244

  Fly   264 LINNYRIVQDLNNRTVFY 281
            ...|.|.|||...|:|::
plant   245 FETNSRPVQDSKGRSVWF 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 67/259 (26%)
ACA4NP_193831.1 PLN02179 1..226 CDD:177835 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.