DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca15b

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_005169499.1 Gene:ca15b / 791844 ZFINID:ZDB-GENE-040426-2222 Length:320 Species:Danio rerio


Alignment Length:254 Identity:79/254 - (31%)
Similarity:117/254 - (46%) Gaps:38/254 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 SGKHQSPILLDSRTARKWVLPGITFWHY--YRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGG 103
            :|..||||  :..||.......:|.:.|  |........|:|.|.||.    ||.:.:|..:.||
Zfish    47 NGTQQSPI--NIVTANVKANANLTSFTYVGYNDSTALTVIKNTGTSIQ----VTLDPKKMRVAGG 105

  Fly   104 RLKGRYYADGLHFHWGSYKSR-GSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIM 167
            .|.||:.:...|.|||:..:. ||||.:|.:||..|:|||  |:...|.:      |.|||:.:.
Zfish   106 NLPGRFASTEFHLHWGNGSAMPGSEHTVNGKRFPMELHIV--NKPVSNTS------DSLAVLGVF 162

  Fly   168 VAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDE 232
            :. ...:..|......|...:.|:......|::|...|:|.|:.||....::.|.||||||.|:|
Zfish   163 IE-ASNETGKPESWKTLTSYLTRIVKAGDKASLFRNFSMDDLLSGVDRTKYYRYLGSLTTPNCNE 226

  Fly   233 TVTWIVFTE------------TTTVTMSSVSKFWLLRDHWGHRLINNYRIVQDLNNRTV 279
            .|.|.||.:            :|||.:::.|...|        :.|.:|.||.:|.|.|
Zfish   227 GVIWTVFKDPIRVSRDLIDLFSTTVYINNSSNSPL--------MTNIFRSVQPVNGRIV 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 77/251 (31%)
ca15bXP_005169499.1 alpha_CA_IV_XV_like 48..279 CDD:239391 79/253 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579091
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.