DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and car1_predicted

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001072785.1 Gene:car1_predicted / 780246 -ID:- Length:258 Species:Xenopus tropicalis


Alignment Length:243 Identity:80/243 - (32%)
Similarity:128/243 - (52%) Gaps:18/243 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 HQSPILLDSRTAR-KWVLPGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRLKG 107
            |||||.:::|||: ...|..:.|.:..:..||   |.|.||..:::.....:  |..::.|.|.|
 Frog    15 HQSPININTRTAKYNPSLKPLKFSYDPKTAKR---IVNVGHCFNVEFEDICD--KSVLSEGPLDG 74

  Fly   108 RYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIV 171
            .|.....||||||....||||.|:...:.||:||||.| :||.:.|:|.:..||:|||.:.:.:.
 Frog    75 HYRLCQFHFHWGSSDRDGSEHNIDGHLYPAELHIVHWNSKKYTSFAEAAKHPDGVAVVGVFLKLG 139

  Fly   172 RKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTW 236
            ..:.|    |..::|.:.:|..: ..|..|.:..|:.|:  ....:::||.|||||....|.|||
 Frog   140 NTNPA----LQSIIENLDKVKTK-GKACPFTEFHLNGLL--PEDLNYWTYMGSLTTKPYFECVTW 197

  Fly   237 IVFTETTTVTMSSVSKFWLLR----DHWGHRLINNYRIVQDLNNRTVF 280
            |:..|..||:...:.:|..|:    :.....::.|:|.||.|::|.|:
 Frog   198 IILQEAITVSSQQLEQFRRLQCTSENENPSFILENHRPVQPLDHRVVY 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 78/239 (33%)
car1_predictedNP_001072785.1 alpha_CA 16..247 CDD:381753 79/242 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.