DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca13

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001072448.1 Gene:ca13 / 779902 XenbaseID:XB-GENE-992707 Length:263 Species:Xenopus tropicalis


Alignment Length:296 Identity:87/296 - (29%)
Similarity:126/296 - (42%) Gaps:82/296 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EWNYL-KNGKD-WEDL--CSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIR------ 79
            :|.|. .||.: |.||  .::|..||||.:.:|.|            .|....:|..:.      
 Frog     4 QWGYEDHNGPEVWHDLFPLANGDRQSPINIITRDA------------IYDPSLQPLQVNYDHDSA 56

  Fly    80 ----NNGHSISL------DIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRR 134
                |.||:.::      |..|...|  |||      |.|.....||||||....||||.::...
 Frog    57 KVVINTGHTFTMEFDDGDDTSVLRGG--PFI------GSYRLRQFHFHWGSSDGHGSEHKVDGMD 113

  Fly   135 FDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAV------VRVP 192
            :.||:||||.| ||:.:..:|....|||||:.:.:.|       ..| :|.:|.:      :|..
 Frog   114 YAAELHIVHWNSEKFSSFVEAACAPDGLAVLGVFLKI-------GEP-NRYIERITDTFGAIRSK 170

  Fly   193 IEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLR 257
            .:.|..|.|..|.|..     :..||:||.||||.|...|:|||:|..|..:::...:::|    
 Frog   171 GKQSPFTNFDPSCLLP-----ASMDFWTYPGSLTVPPLLESVTWVVLKEPISISHEQLARF---- 226

  Fly   258 DHWGHRLI--------------NNYRIVQDLNNRTV 279
                ..|:              :|:|.||.|.||.|
 Frog   227 ----RSLLFTKDTAEIEACCMKSNHRPVQPLKNRKV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 85/292 (29%)
ca13NP_001072448.1 alpha_CA 1..262 CDD:320708 87/296 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.