DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CA8

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001308766.1 Gene:CA8 / 767 HGNCID:1382 Length:290 Species:Homo sapiens


Alignment Length:282 Identity:86/282 - (30%)
Similarity:144/282 - (51%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QSTNGMEWNYLKNGKDW----EDLCSSGKHQSPILLDSRTAR-KWVLPGITFWHYYRLLKRPFYI 78
            :...|:||.| :.|.:|    .|  ::|::||||.|:||.|| ...|..:.....| ::.|...:
Human    22 EEEEGVEWGY-EEGVEWGLVFPD--ANGEYQSPINLNSREARYDPSLLDVRLSPNY-VVCRDCEV 82

  Fly    79 RNNGHSISLDIPVTSNGRKPFITGGRLKGRYYAD--GLHFHWGSYKSRGSEHLINKRRFDAEIHI 141
            .|:||:|.:.:.     .|..::||.|...:..:  .:.||||....|||||.:|.:.|..|:|:
Human    83 TNDGHTIQVILK-----SKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHL 142

  Fly   142 VHRNEK-YRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATV--FGQ 203
            :|.|.. :.:|.:||.:..|:|::|:.|.|    ..:...|..:.|.:..:..:..:.|:  |..
Human   143 IHWNSTLFGSIDEAVGKPHGIAIIALFVQI----GKEHVGLKAVTEILQDIQYKGKSKTIPCFNP 203

  Fly   204 SSL--DQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDH-WGHRLI 265
            ::|  |.|:     ||::.||||||.|.|.|.||||:|....|::...:.:|..||.| .|..|:
Human   204 NTLLPDPLL-----RDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELV 263

  Fly   266 --------NNYRIVQDLNNRTV 279
                    :|:|..|.|::|.:
Human   264 EGCDGILGDNFRPTQPLSDRVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 83/272 (31%)
CA8NP_001308766.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 0/3 (0%)
alpha_CARP_VIII 35..289 CDD:239394 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145697
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.