DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca10a

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001032198.1 Gene:ca10a / 641327 ZFINID:ZDB-GENE-051030-123 Length:328 Species:Danio rerio


Alignment Length:274 Identity:75/274 - (27%)
Similarity:129/274 - (47%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGH------- 83
            |..:.:.  | :|||.||.|||:.::  |:.....|.:|          |..:...|.       
Zfish    50 WGLVNSA--W-NLCSVGKRQSPVNIE--TSHMIFDPFLT----------PLRLNTGGRKVGGTMY 99

  Fly    84 ------SISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIV 142
                  |:.||.....|     |:||.:...:..:.:..|:||...:|||||:|.:.|..|:.::
Zfish   100 NTGRHVSLRLDKEHLVN-----ISGGPMTYSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLI 159

  Fly   143 HRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLM--EAVVRVPIEDSNATVFGQS 204
            |.| |.|.|..:|.:..:||.:|:|.:.|....|:.   |:|::  :.:.|:..: ::|.:....
Zfish   160 HYNHELYTNYTEAAKSPNGLVIVSIFMKISETSNSF---LNRMLNRDTITRITYK-NDAYLLSGL 220

  Fly   205 SLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLI---- 265
            :::::....:  .|.|||||:|.|.|.||.|||:..:...||...:....||..:...::.    
Zfish   221 NIEEVYPETA--SFITYEGSMTIPPCYETATWILMNKPIYVTKMQMHSMRLLSQNQPSQIFLSMS 283

  Fly   266 NNYRIVQDLNNRTV 279
            :|.|.||.||||.:
Zfish   284 DNVRPVQPLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 74/271 (27%)
ca10aNP_001032198.1 alpha_CARP_X_XI_like 46..302 CDD:239395 75/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.