DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca5a

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001104671.1 Gene:ca5a / 569989 ZFINID:ZDB-GENE-080220-57 Length:310 Species:Danio rerio


Alignment Length:261 Identity:85/261 - (32%)
Similarity:132/261 - (50%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 WED--LCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPF------YIRNNGHSISLDIPV 91
            |::  ....|..||||.::.|.:        .|....|.||..:      .|.|||:|..::...
Zfish    53 WQEPLAIPGGDRQSPIDIEVRKS--------IFNPQLRPLKVQYDPRTCQQIWNNGYSFLVEYDD 109

  Fly    92 TSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRN-EKYRNIAQAV 155
            |::  |..:.||.|:.:|.....|||||...:.||||.|::|.:.||:||||.| :||....:||
Zfish   110 TTD--KSTVKGGPLENQYRLCQFHFHWGENNNWGSEHSIDRRLYAAELHIVHWNSDKYSLFEEAV 172

  Fly   156 RQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDS--NATVFGQSSLDQLIGGVSHRDF 218
            .:::||||:.:.:.:.::...    |.:|::|:..|..:||  ....|..|.|  |...:|  |:
Zfish   173 MEENGLAVIGVFLKVGKRHEG----LQKLVDALPAVRHKDSVVEFNKFDPSCL--LPENIS--DY 229

  Fly   219 FTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLL-----RDHWGHRLINNYRIVQDLNNRT 278
            :||.||||||...|.|||||..:...|:...::.|..|     .:.....::||:|:.|||..|.
Zfish   230 WTYPGSLTTPPLTEAVTWIVMKQHIEVSHDQLAVFRSLLFTSAEEQVQRSMVNNFRVQQDLKGRA 294

  Fly   279 V 279
            |
Zfish   295 V 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 83/258 (32%)
ca5aNP_001104671.1 alpha_CA 62..299 CDD:294017 84/252 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579065
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.