DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CA10

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001076002.1 Gene:CA10 / 56934 HGNCID:1369 Length:328 Species:Homo sapiens


Alignment Length:275 Identity:78/275 - (28%)
Similarity:133/275 - (48%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSIS---- 86
            |..:.:.  | :|||.||.|||:.::  |:.....|.:|          |..|...|..:|    
Human    50 WGLVNSA--W-NLCSVGKRQSPVNIE--TSHMIFDPFLT----------PLRINTGGRKVSGTMY 99

  Fly    87 ---------LDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIV 142
                     ||.....|     |:||.:...:..:.:..|:||..|:|||||:|.:.|..|:.::
Human   100 NTGRHVSLRLDKEHLVN-----ISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLI 159

  Fly   143 HRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTP-LSRLM--EAVVRVPIEDSNATVFGQ 203
            |.| |.|.|:.:|.:..:||.||:|.:    |.:..|.| |:|::  :.:.|:..: ::|.:...
Human   160 HYNHELYTNVTEAAKSPNGLVVVSIFI----KVSDSSNPFLNRMLNRDTITRITYK-NDAYLLQG 219

  Fly   204 SSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLI--- 265
            .::::|....|  .|.||:||:|.|.|.||.:||:..:...:|...:....||..:...::.   
Human   220 LNIEELYPETS--SFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSM 282

  Fly   266 -NNYRIVQDLNNRTV 279
             :|:|.||.||||.:
Human   283 SDNFRPVQPLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 77/272 (28%)
CA10NP_001076002.1 alpha_CARP_X_XI_like 46..302 CDD:239395 78/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.