DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca10b

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_005164153.1 Gene:ca10b / 568543 ZFINID:ZDB-GENE-080815-2 Length:326 Species:Danio rerio


Alignment Length:286 Identity:78/286 - (27%)
Similarity:131/286 - (45%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LPLAFYQSTNGMEWNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFY 77
            :|:..:.......||          ||:.||.|||:.:::.                |::..||.
Zfish    43 IPVPSFWGLVNTAWN----------LCAIGKRQSPVNIETS----------------RMIFDPFL 81

  Fly    78 --IRNNGHSISLDIPVTSNGR----KP------FITGGRLKGRYYADGLHFHWGSYKSRGSEHLI 130
              :|.|.....:...:.:.||    :|      .|:||.|...|..:.:..|:||..:||||||:
Zfish    82 NPLRLNAGQRKVSGTMYNTGRHVSLRPDKSHLVNISGGPLSYSYRLEEIRLHFGSEDNRGSEHLL 146

  Fly   131 NKRRFDAEIHIVHRNEK-YRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLM--EAVVRVP 192
            |.:.|..|:.::|.|:. |.|.:.|||..:|:|||:|.:.|....|..   |:|::  |.|.|:.
Zfish   147 NGQAFPGEVQLIHYNQDLYLNYSDAVRSPNGIAVVSIFMKISEPTNVF---LNRMLNRETVTRIT 208

  Fly   193 IEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLR 257
            .:.....:.| .::::|....|.  |.|||||:|.|.|.||.|||:..:...::...:....||.
Zfish   209 YKHDAYLLMG-LNIEELYPETSR--FITYEGSITIPPCLETATWILMNKPIYISQIEMQSLRLLS 270

  Fly   258 DHWGHRLI----NNYRIVQDLNNRTV 279
            .:...::.    :|.|..|.|:.|.:
Zfish   271 QNQPSQIFLSMGDNMRPTQTLHQRCI 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 76/270 (28%)
ca10bXP_005164153.1 PLN02179 7..257 CDD:177835 71/245 (29%)
alpha_CARP_X_XI_like 45..301 CDD:239395 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.