DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca7

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_957107.1 Gene:ca7 / 564201 ZFINID:ZDB-GENE-040426-1786 Length:263 Species:Danio rerio


Alignment Length:276 Identity:90/276 - (32%)
Similarity:131/276 - (47%) Gaps:39/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 GMEWNYLK-NG-----KDWEDLCSSGKHQSPI-------LLDSRTARKWVLPGITFWHYYRLLKR 74
            |..|.|.: ||     ||:.  .:.|..||||       :.||:.:     |....::....|. 
Zfish     3 GHHWGYGEDNGPSAWHKDYP--IAEGNRQSPIDIVPSEAVFDSKLS-----PISLSYNNCTSLS- 59

  Fly    75 PFYIRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEI 139
               |.|||||:.::...|.  .:..||||.|:..|.....||||||....||||.:..:.|.:|:
Zfish    60 ---ISNNGHSVVVEFVDTD--ERSVITGGPLENMYRLKQFHFHWGSKGCCGSEHTVAGKTFVSEL 119

  Fly   140 HIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQ 203
            |:||.| .||::.::|....|||||:.|.:....:..|    |.::.:|:..|..:.|.|...|.
Zfish   120 HLVHWNANKYKSFSEAAAAPDGLAVLGIFLETGDEHRA----LHQITDALYMVRFKGSLAEFKGF 180

  Fly   204 SSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLL-----RDHWGHR 263
            :....|...:   :::||.||||||...|:|||||..|...|:...:.||..|     .:...:|
Zfish   181 NPKCLLPNSL---EYWTYPGSLTTPPLYESVTWIVLKEPIYVSEKQMGKFRTLLFNGEEEEDRNR 242

  Fly   264 LINNYRIVQDLNNRTV 279
            :.||||..|.|..|.|
Zfish   243 MENNYRPPQPLKGRMV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 87/270 (32%)
ca7NP_957107.1 alpha_CA_VII 26..262 CDD:239402 83/251 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579110
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.660

Return to query results.
Submit another query.