DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ptprga

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001316793.1 Gene:ptprga / 561197 ZFINID:ZDB-GENE-101101-4 Length:1414 Species:Danio rerio


Alignment Length:248 Identity:73/248 - (29%)
Similarity:119/248 - (47%) Gaps:20/248 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 KHQSPI-LLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRLK 106
            ::|||| :.|..|........:|...:.........::|.|.::::.:.     ...|:.|..|.
Zfish    81 RNQSPINIADQDTKVSMEYQELTLDGFDAESSNKTSMKNTGKTVAIFLK-----DDYFVRGAGLP 140

  Fly   107 GRYYADGLHFHWG-SYKSRGSEHLINKRRFDAEIHI-VHRNEKYRNIAQAVRQKDGLAVVAIMVA 169
            ||:.|:.:.|||| |..|.||||.||.|||..|:.| ::.::.:.::..|:|:|..:|.:|:...
Zfish   141 GRFKAEKVEFHWGQSNGSDGSEHSINGRRFPVEMQIFMYNSDDFDSLNTAIREKRVIAAMAVFFQ 205

  Fly   170 IVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETV 234
            :..|||....|:...:..||....|........:..|...||     .::.|.||||||.|.:.|
Zfish   206 VDFKDNPAVDPIIHGLRGVVHHEKETFLEPFVLRDLLPSSIG-----SYYRYIGSLTTPPCSKVV 265

  Fly   235 TWIVFTETTTVTMSSVSKFWLL-----RDHWG--HRLINNYRIVQDLNNRTVF 280
            .||||:....::...:..|:.:     :||..  ..|.||:|.:|.|:||.||
Zfish   266 EWIVFSRPVLLSYKQLEAFYSIFTTEQQDHVKSVEYLRNNFRPLQSLDNREVF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 70/244 (29%)
ptprgaNP_001316793.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.