DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca8

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001017571.2 Gene:ca8 / 550233 ZFINID:ZDB-GENE-050417-26 Length:281 Species:Danio rerio


Alignment Length:290 Identity:83/290 - (28%)
Similarity:142/290 - (48%) Gaps:53/290 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YQSTNGMEWNYLKNGKDWEDLC--SSGKHQSPILLDSRTARKWVLPGITFWHYYRLLK---RPFY 77
            |...:.::|.| :.|.:|..|.  ::|::||||.|:||.||          :..:||.   .|.|
Zfish    12 YPGKDELDWGY-EEGVEWGLLFPEANGEYQSPINLNSREAR----------YDPQLLDVGLNPNY 65

  Fly    78 -------IRNNGHSISLDIPVTSNGRKPFITGGRLKG--RYYADGLHFHWGSYKSRGSEHLINKR 133
                   :.|:||::.:.:.     .|..:|||.|..  .|....:.||||....|||||.:|.:
Zfish    66 VVCRDCEVINDGHTVRIMLK-----SKSVVTGGPLPSDHEYELSEVRFHWGKENQRGSEHTVNFK 125

  Fly   134 RFDAEIHIVHRNEK-YRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSN 197
            .|..|:|::|.|.. :.::.:|:.:|.|:.::|:.|.:    ..:...|..:.:.:..:..:...
Zfish   126 AFPMELHLIHWNSTLFNSVEEAMGKKRGILIIALFVQV----GKEHLGLKAITDVLQDLQYKGKT 186

  Fly   198 ATV--FGQSSL--DQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRD 258
            ..:  |..::|  |.|:     ||::.||||||||.|.|.||||::....|::...:.:|..||.
Zfish   187 KIIPCFNPNTLLPDPLL-----RDYWVYEGSLTTPPCSENVTWILYRYPLTISQMQIEEFRRLRS 246

  Fly   259 H-------WGH--RLINNYRIVQDLNNRTV 279
            |       .|:  .|.:|:|..|.|::|.|
Zfish   247 HVKGAELPEGNDGMLGDNFRPTQPLSDRVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 80/279 (29%)
ca8NP_001017571.2 alpha_CARP_VIII 25..280 CDD:239394 80/276 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579105
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.