DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca7

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001015903.1 Gene:ca7 / 548657 XenbaseID:XB-GENE-1017206 Length:266 Species:Xenopus tropicalis


Alignment Length:271 Identity:81/271 - (29%)
Similarity:132/271 - (48%) Gaps:34/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNG--KDWEDL--CSSGKHQSPILLDSRTA--RKWVLPGITFWHYYRLLKRPFYIRNNGHS 84
            |.|.:..  .:|...  .:.|..||||.:.|..|  ...:.|.:..:.:...:.    :.|||||
 Frog     7 WGYGEEDGPSEWHHYFPIAEGNRQSPIDIVSNQAVFNPSLNPLVISYDHCTSIN----LSNNGHS 67

  Fly    85 ISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEK-Y 148
            :.::.....:  |..||||.|:|.|.....|||||:.::.||||.::.:.:..|:|:||.|.: |
 Frog    68 VMVEFDDYDD--KTVITGGPLEGSYRLKQFHFHWGTQRNSGSEHTVDGKSYPCELHLVHWNARAY 130

  Fly   149 RNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGV 213
            .:..:|....|||.|:.:.:    :...:.:.|:||.:|:..|..:.:. |.|...:...|:  .
 Frog   131 SSFGEAAAAPDGLVVIGVFL----ETGGQHSGLNRLTDALYMVKFKGTK-TQFDDFNPKCLL--P 188

  Fly   214 SHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKF--WLL--------RDHWGHRLINNY 268
            |..:::||.||||||..:|:|||||..|...|:...:.:|  .||        |.|    ::||:
 Frog   189 SSFEYWTYPGSLTTPPLNESVTWIVLKEPIKVSEKQMERFRKTLLFSGEEEEQRIH----MVNNF 249

  Fly   269 RIVQDLNNRTV 279
            |..|.|..|.|
 Frog   250 RPPQPLKGRKV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 79/268 (29%)
ca7NP_001015903.1 alpha_CA_VII 27..264 CDD:239402 78/251 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.