DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Car2

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_062164.1 Gene:Car2 / 54231 RGDID:2240 Length:260 Species:Rattus norvegicus


Alignment Length:274 Identity:91/274 - (33%)
Similarity:136/274 - (49%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLK-NG-KDW--EDLCSSGKHQSPILLDSRTARKWVLPGITFWH----------YYRLLKRPF 76
            |.|.| || ::|  |...::|..|||:.:|:.||:          |          |.::..:. 
  Rat     5 WGYSKSNGPENWHKEFPIANGDRQSPVDIDTGTAQ----------HDPSLQPLLICYDKVASKS- 58

  Fly    77 YIRNNGHSISLDIPVTSNGRKPF--ITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEI 139
             |.|||||.:::.    :..:.|  :..|.|.|.|.....||||||...:||||.:||:::.||:
  Rat    59 -IVNNGHSFNVEF----DDSQDFAVLKEGPLSGSYRLIQFHFHWGSSDGQGSEHTVNKKKYAAEL 118

  Fly   140 HIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQS 204
            |:||.|.||.:..:||:..|||||:.|.:.|    ...|..|.::.||:..:..:...|......
  Rat   119 HLVHWNTKYGDFGKAVQHPDGLAVLGIFLKI----GPASQGLQKITEALHSIKTKGKRAAFANFD 179

  Fly   205 SLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLR-DHWGHR---LI 265
            ....|.|.:   |::||.||||||...|.|||||..|..||:...:|.|..|. :..|..   ::
  Rat   180 PCSLLPGNL---DYWTYPGSLTTPPLLECVTWIVLKEPITVSSEQMSHFRKLNFNSEGEAEELMV 241

  Fly   266 NNYRIVQDLNNRTV 279
            :|:|..|.|.||.:
  Rat   242 DNWRPAQPLKNRKI 255

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 90/271 (33%)
Car2NP_062164.1 alpha_CA 1..259 CDD:294017 91/274 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..39 8/22 (36%)