DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CAH9

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_651535.1 Gene:CAH9 / 43264 FlyBaseID:FBgn0039486 Length:311 Species:Drosophila melanogaster


Alignment Length:291 Identity:106/291 - (36%)
Similarity:158/291 - (54%) Gaps:18/291 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIAFHKLLLLLPLAFYQSTNGMEWNYLK-NGKDW---EDLCSSGKHQSPILLDSRTARKWVLP 61
            |:..||.:...|| :.:.|:.:...:.|.: |.:.|   ...| :||.||||.:.:.......:|
  Fly     1 MKLTAFLEASFLL-ICWSQAVSSHVFGYSEPNQRRWARHHGHC-AGKTQSPIAITTSRTTAIHMP 63

  Fly    62 GITFWHYYRLLKRPFYIRNNGHSISLDIP---VTSNGRK--PFITGGRLKGRYYADGLHFHWGSY 121
            .:....|:.||..|..:.||||::|:.||   ||..|..  |:|.|.:|.|.:..:|||||||..
  Fly    64 AVDMIGYHNLLPYPLKMINNGHTVSITIPKVNVTEVGEDFLPYIRGAKLPGEFEVEGLHFHWGDK 128

  Fly   122 KSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLME 186
            .:|||||:||..|:..|:||||||:||..|.:|:...||.||:.....:...:.|....::|.:.
  Fly   129 NNRGSEHVINDIRYTMEMHIVHRNKKYATIGEALNHPDGAAVLGFFFNLDEDEGAGLVTINRHLH 193

  Fly   187 AVVRVPIEDSN--ATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSS 249
            .     |.|:|  ||:....||..||.||....|:||:||||||.|.|.||||:|.:...::...
  Fly   194 L-----IADANQEATLNVTFSLSSLIAGVDVDKFYTYKGSLTTPPCSEAVTWILFPDPIPISPKQ 253

  Fly   250 VSKFWLLRDHWGHRLINNYRIVQDLNNRTVF 280
            :|:|..|.|.....|::|:|.:|.:.||.:|
  Fly   254 ISRFRQLSDTQDGALVDNFRTLQPVGNRRIF 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 98/262 (37%)
CAH9NP_651535.1 Carb_anhydrase 25..282 CDD:215000 98/262 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450182
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm6335
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.