DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CAH2

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_648555.1 Gene:CAH2 / 39390 FlyBaseID:FBgn0027843 Length:335 Species:Drosophila melanogaster


Alignment Length:289 Identity:92/289 - (31%)
Similarity:145/289 - (50%) Gaps:26/289 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIAFHKLLLLLPLAF-----YQSTNGME-WNYLKNGKDWEDLC-SSGKHQSPILLDSRTARKWVL 60
            ||....:|:...|..     |:..:|.| |:        ||.. .||||||||.:|..:|.:...
  Fly    10 AIVIAPILICASLVLAQDFGYEGRHGPEHWS--------EDYARCSGKHQSPINIDQVSAVEKKF 66

  Fly    61 PGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRLKGR----YYADGLHFHWGSY 121
            |.:.|:: ::::.....:.||||::.:.:....: ..|.:.||.|..:    |..:..|||||..
  Fly    67 PKLEFFN-FKVVPDNLQMTNNGHTVLVKMSYNED-EIPSVRGGPLAEKTPLGYQFEQFHFHWGEN 129

  Fly   122 KSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLME 186
            .:.|||.|||.|.:.||:|:|.||.:|.:.|.|:.:..|:||:|....:..|........:.|:.
  Fly   130 DTIGSEDLINNRAYPAELHVVLRNLEYPDFASALDKDHGIAVMAFFFQVGDKSTGGYEGFTNLLS 194

  Fly   187 AVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVS 251
            .:.|   :..:..:.....|.:.| ..|...:|:|.||||||.|.|.||||.||....:|...::
  Fly   195 QIDR---KGKSVNMTNPLPLGEYI-SKSVESYFSYTGSLTTPPCSEEVTWIDFTTPIDITEKQLN 255

  Fly   252 KFWLLRDHWGHRLINNYRIVQDLNNRTVF 280
            .|.||..:..| |.||:|.:|.||:||::
  Fly   256 AFRLLTANDDH-LKNNFRPIQPLNDRTLY 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 83/256 (32%)
CAH2NP_648555.1 Carb_anhydrase 28..281 CDD:215000 86/267 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
109.870

Return to query results.
Submit another query.