DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CAH15

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_611525.1 Gene:CAH15 / 37366 FlyBaseID:FBgn0034560 Length:332 Species:Drosophila melanogaster


Alignment Length:269 Identity:66/269 - (24%)
Similarity:113/269 - (42%) Gaps:36/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EWNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSISLDI 89
            :|:  :....|:..|:   :||||.:|..............|.:|..:.....:.||||::.|..
  Fly    85 DWD--QGPHTWDTACN---NQSPINIDMNCVEINYFDTPLIWSHYNSIPLGIRLENNGHTLILRA 144

  Fly    90 PVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQA 154
            ....  |.|.|.||.|.||:....:.|.|....|.||||.::......|:..:|.:   .:....
  Fly   145 AFPE--RTPSIDGGDLLGRFDFREISFRWSWASSLGSEHTLDHHHSPLEMQCLHTD---GDGCDG 204

  Fly   155 VRQKDGLAVVAIMVAIVRKDNAKSTP--------LSRLMEA--VVRVPIEDSNATVFGQSSLDQL 209
            .....|:.:::.|.     |.::..|        |:.:.:|  ||.||          ...|..|
  Fly   205 CSSSQGVLMISYMF-----DLSEHNPFLDVLIQHLAAVEQAGQVVEVP----------PFPLSYL 254

  Fly   210 IGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLINNYRIVQDL 274
            :... :..|::|.||||.|.|.....|:::.|:..::...:::|..|||..|.|:..|.|.||.:
  Fly   255 MSPF-YDKFYSYNGSLTEPPCHRGAEWLIYPESLAISERQLNEFRQLRDRRGSRIARNARPVQPI 318

  Fly   275 NNRTVFYKK 283
            .:|.|:..:
  Fly   319 GDRMVYLNR 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 64/261 (25%)
CAH15NP_611525.1 alpha_CARP_receptor_like 82..325 CDD:239396 66/265 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446806
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.