DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CAH13

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_610602.2 Gene:CAH13 / 36126 FlyBaseID:FBgn0033542 Length:527 Species:Drosophila melanogaster


Alignment Length:308 Identity:80/308 - (25%)
Similarity:128/308 - (41%) Gaps:44/308 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIAFH-----------KLLLLL--PLAF--------------YQSTNGMEWNYLKNGKDWEDLCS 40
            |.|:|           ::|||:  ||.|              |...:|......|:......:..
  Fly    43 AFAYHADQETLKEIYQRVLLLIRTPLQFGNTSCSRNSAPVYGYDMQHGPHTWLPKSRSSSSSVEE 107

  Fly    41 SGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRL 105
            :...|||:.:|....::..:..:..|::|..|.....:.|.|.::.|  ....:|..|.|:|..|
  Fly   108 ATFFQSPVNIDESQIQRMAIRELLSWNHYDDLPASITLENTGQTLIL--RAQFHGNAPTISGADL 170

  Fly   106 KGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAI 170
            ...|....|.||||...|.||||.||.|:|..|:.::|:...  .|.:.......|    :|:..
  Fly   171 LASYTFLELRFHWGWCNSEGSEHTINHRKFPLEMQVMHKTGS--GIPRTCTSSYDL----LMIGY 229

  Fly   171 VRKDNAKSTPLSRLME--AVVRVPIEDSNATVFGQSSL-DQLIGGVSHRDFFTYEGSLTTPLCDE 232
            |.:.:|.:..|..|::  .:|:.|.:....:.|..|.| .|...|     |::|.||||.|.|.:
  Fly   230 VFELSAHNPFLDPLVQNLRLVQKPGKRVQISPFPISYLMYQFRSG-----FYSYGGSLTHPPCYQ 289

  Fly   233 TVTWIVFTETTTVTMSSVSKFWLLRDHWG-HRLINNYRIVQDLNNRTV 279
            ...|.:|.|:..::...:..|.||....| ..:..|.|.||.:.||.|
  Fly   290 GTEWFIFPESLAISDFQLRHFRLLLGPDGISPIARNSRPVQHMGNRVV 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 67/255 (26%)
CAH13NP_610602.2 alpha_CARP_receptor_like 90..339 CDD:239396 70/261 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446805
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.