DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CAH1

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_523561.1 Gene:CAH1 / 34786 FlyBaseID:FBgn0027844 Length:270 Species:Drosophila melanogaster


Alignment Length:277 Identity:79/277 - (28%)
Similarity:129/277 - (46%) Gaps:44/277 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYL-KNG-----KDWEDLCSSGKHQSPILLDSRTARKW----VLPGITFWHYYRLLKRPFYIR- 79
            |.|. :||     |::..  :||..|||:.:...:|:|.    |.|  ..|.|.     |.:.: 
  Fly     5 WGYTEENGPAHWAKEYPQ--ASGHRQSPVDITPSSAKKGSELNVAP--LKWKYV-----PEHTKS 60

  Fly    80 --NNGHSISLDIPVTSNGRKPFITGGRLKGRYY-ADGLHFHWGSYKSRGSEHLINKRRFDAEIHI 141
              |.|:...:|:    ||....:|||.|..:.: .:..|.|||...|:||||.::...:..|:|:
  Fly    61 LVNPGYCWRVDV----NGADSELTGGPLGDQIFKLEQFHCHWGCTDSKGSEHTVDGVSYSGELHL 121

  Fly   142 VHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSS 205
            ||.| .||::..:|....|||||:.:.:. ....:|:...::.|::.|:.   :....|:.....
  Fly   122 VHWNTTKYKSFGEAAAAPDGLAVLGVFLK-AGNHHAELDKVTSLLQFVLH---KGDRVTLPQGCD 182

  Fly   206 LDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLR----------DHW 260
            ..||:..|  ..::|||||||||.|.|:|.||||.....|:...::....|.          :.:
  Fly   183 PGQLLPDV--HTYWTYEGSLTTPPCSESVIWIVFKTPIEVSDDQLNAMRNLNAYDVKEECPCNEF 245

  Fly   261 GHRLINNYRIVQDLNNR 277
            ..::|||:|....|..|
  Fly   246 NGKVINNFRPPLPLGKR 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 79/277 (29%)
CAH1NP_523561.1 Carb_anhydrase 5..263 CDD:215000 79/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446784
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D113047at6656
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
1110.800

Return to query results.
Submit another query.