DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CARPA

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001284986.1 Gene:CARPA / 31687 FlyBaseID:FBgn0029962 Length:333 Species:Drosophila melanogaster


Alignment Length:271 Identity:77/271 - (28%)
Similarity:118/271 - (43%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EWNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYI---------RN 80
            :||          :|:.|:.||||  |       |:|....:..|   .||.:|         .|
  Fly    56 QWN----------MCNKGRRQSPI--D-------VVPDKLLFDPY---LRPLHIDKHKVSGTLHN 98

  Fly    81 NGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRN 145
            .|.|:...:...:. :...|:||.|..||..:.::.|:|:...|||||.|....|..||.|...|
  Fly    99 TGQSLVFRVDKDTK-QHVNISGGPLAYRYQFEEIYIHYGTENVRGSEHFIQGYSFPGEIQIYGFN 162

  Fly   146 -EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQL 209
             |.|.|:::|..:..|:..:::||.|....|    |..|::.:.....:....:|.....|:..|
  Fly   163 KELYHNMSEAQHKSQGIVGLSLMVQIGETPN----PELRIITSTFNKVLYRGFSTPIRHISVRSL 223

  Fly   210 IGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHR------LINNY 268
            :....|  :.|||||.|.|.|.|:..||:..:...:|...:  :.|.|...|..      |.||.
  Fly   224 LPNTDH--YITYEGSTTHPGCWESTVWIIVNKPIYITKQEL--YQLRRLMQGSESTPKAPLGNNA 284

  Fly   269 RIVQDLNNRTV 279
            |.||.|::|||
  Fly   285 RPVQSLHHRTV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 74/267 (28%)
CARPANP_001284986.1 alpha_CARP_X_XI_like 46..300 CDD:239395 77/271 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I2610
eggNOG 1 0.900 - - E1_COG3338
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I2251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm1014
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.