DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Ca6

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001128313.1 Gene:Ca6 / 298657 RGDID:70516 Length:312 Species:Rattus norvegicus


Alignment Length:278 Identity:88/278 - (31%)
Similarity:132/278 - (47%) Gaps:47/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EWNYLKNGKD------WEDLCSS--GKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFY---- 77
            ||:|  :|.|      |.:...|  |:.||||.:..|..           |:...| .|.:    
  Rat    20 EWSY--SGDDGLEESRWPEKYPSCGGERQSPIDVKRREV-----------HFSSSL-LPLHMVNY 70

  Fly    78 --------IRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSR--GSEHLINK 132
                    :.||||::.:.:|.|.:.|.   :.|.:   |....:|||||...|.  ||||.|:.
  Rat    71 EEEGLELSMTNNGHTVQITLPNTMSMRD---SDGTV---YRTKQMHFHWGGRDSEISGSEHTIDG 129

  Fly   133 RRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSN 197
            .|...|||:||.||||....:||.|.|||||:|::|.:  :|..::...|..:..:..|......
  Rat   130 MRHAIEIHLVHFNEKYETYEKAVDQPDGLAVMAVLVKV--EDYTENDYYSTFISELENVKYTGQT 192

  Fly   198 ATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFW-LLRDHWG 261
            .|:...:..:.|.|.:.|  ::||:||||||.|.|.|.|.||.::.|::.:...:.. .:.||..
  Rat   193 TTLRNVNIRNMLPGDIRH--YYTYQGSLTTPPCTENVKWFVFQDSATISKAQAERIENAVMDHHN 255

  Fly   262 HRLINNYRIVQDLNNRTV 279
            ..:.|.||..|.|:||.|
  Rat   256 QTIRNGYRRTQPLHNRVV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 85/274 (31%)
Ca6NP_001128313.1 alpha_CA_VI 30..278 CDD:239399 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339390
Domainoid 1 1.000 146 1.000 Domainoid score I4412
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 146 1.000 Inparanoid score I4322
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm44493
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.