DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Ca8

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001009662.1 Gene:Ca8 / 297814 RGDID:1304709 Length:290 Species:Rattus norvegicus


Alignment Length:282 Identity:86/282 - (30%)
Similarity:145/282 - (51%) Gaps:39/282 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 QSTNGMEWNYLKNGKDW----EDLCSSGKHQSPILLDSRTAR-KWVLPGITFWHYYRLLKRPFYI 78
            :...|:||.| :.|.:|    .|  ::|::||||.|:||.|| ...|..:.....| ::.|...:
  Rat    22 EEEEGVEWGY-EEGVEWGLVFPD--ANGEYQSPINLNSREARYDPSLLDVRLSPNY-VVCRDCEV 82

  Fly    79 RNNGHSISLDIPVTSNGRKPFITGGRL-KGR-YYADGLHFHWGSYKSRGSEHLINKRRFDAEIHI 141
            .|:||:|.:.:.     .|..::||.| :|: :....:.||||....|||||.:|.:.|..|:|:
  Rat    83 TNDGHTIQVILK-----SKSVLSGGPLPQGQEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHL 142

  Fly   142 VHRNEK-YRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATV--FGQ 203
            :|.|.. :.:|.:||.:..|:.::|:.|.|    ..:...|..:.|.:..:..:..:.|:  |..
  Rat   143 IHWNSTLFGSIDEAVGKPHGIVIIALFVQI----GKEHVGLKAVTEILQDIQYKGKSKTIPCFNP 203

  Fly   204 SSL--DQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDH-WGHRLI 265
            ::|  |.|:     ||::.||||||.|.|.|.||||:|....|::...:.:|..||.| .|..|:
  Rat   204 NTLLPDPLL-----RDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELV 263

  Fly   266 --------NNYRIVQDLNNRTV 279
                    :|:|..|.|::|.:
  Rat   264 EGCDGILGDNFRPTQPLSDRVI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 83/272 (31%)
Ca8NP_001009662.1 alpha_CARP_VIII 35..289 CDD:239394 81/268 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339395
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.