DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Car15

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001099371.1 Gene:Car15 / 288360 RGDID:1306018 Length:323 Species:Rattus norvegicus


Alignment Length:296 Identity:90/296 - (30%)
Similarity:143/296 - (48%) Gaps:25/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQAIAFHKLLLLLPLAFYQSTNGMEWNYLKNGKD-------WEDLCSS--GKHQSPILLDSR-TA 55
            |.|:.| :|..||.||....:|| .|.|  :.:|       |::|..:  |..|||:.:|.| ..
  Rat     1 MWALGF-RLCFLLMLAAQVDSNG-TWCY--DSQDPKCGPAHWKELAPACGGPTQSPVNIDLRLVQ 61

  Fly    56 RKWVLPGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRL-KGRYYADGLHFHWG 119
            |.:.|....|..|....:.|:.:.|:||::.|.:. :.....|.|.|..| ...|....||||||
  Rat    62 RDYALKPFIFHGYDSAPQDPWILENDGHTVLLRVH-SCQQNCPAIRGAGLPSSEYRLLQLHFHWG 125

  Fly   120 SYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRL 184
            |...:||||.::::....|:|:||.|.||:::..|..|.||||::|:::....|||...:.:...
  Rat   126 SPGHKGSEHSVDEKHGSMEMHMVHMNTKYQSMGHARSQPDGLAILAVLLVEEDKDNTNFSAIVSG 190

  Fly   185 MEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSS 249
            ::.|....:..:..:.|..:||  |...:....::.|.||||||.|:..|.|.||..|..:..:.
  Rat   191 LKNVSSPGVSVNLTSTFALASL--LPSALGLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIGHAQ 253

  Fly   250 VSKFWLLRD------HWGHRLINNYRIVQDLNNRTV 279
            |.:|..:..      | ...|.:|:|..|.|..|.:
  Rat   254 VVQFQAVPQTGPPGLH-PRPLTDNFRPQQPLGGRRI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 79/268 (29%)
Car15NP_001099371.1 alpha_CA_IV_XV_like 47..290 CDD:239391 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR18952
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.