DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and CA14

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_036245.1 Gene:CA14 / 23632 HGNCID:1372 Length:337 Species:Homo sapiens


Alignment Length:286 Identity:94/286 - (32%)
Similarity:136/286 - (47%) Gaps:31/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLPLAFYQSTNGMEWNYL-KNGKD-WE---DLCSSGKHQSPILL--DSRTARKWVLPGITFWH 67
            |||..:....:..|..|.|. .:|:| |.   ..|.:.. ||||.:  ||.|... .||.:....
Human     6 LLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNA-QSPIDIQTDSVTFDP-DLPALQPHG 68

  Fly    68 YYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKS-RGSEHLIN 131
            |.:....|..:.||||::.|.:|.|      ...|| |..:|.|..||.|||...| .||||.||
Human    69 YDQPGTEPLDLHNNGHTVQLSLPST------LYLGG-LPRKYVAAQLHLHWGQKGSPGGSEHQIN 126

  Fly   132 KRRFDAEIHIVH-RNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDN-AKSTPLSRLMEAVVRVPIE 194
            .....||:|||| .::.|.::::|..:..||||:.|::.:....| |....||.|.|  ||...:
Human   127 SEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHE--VRHKDQ 189

  Fly   195 DSNATVFG-QSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSK----FW 254
            .::...|. :..|.:.:|     .:|.|.||||||.|.::|.|.||...:.::|..:.|    .:
Human   190 KTSVPPFNLRELLPKQLG-----QYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLF 249

  Fly   255 LLRDHWGHRLINNYRIVQDLNNRTVF 280
            ...:.....|:.|||.:|.||.|.||
Human   250 STEEEPSKLLVQNYRALQPLNQRMVF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 87/266 (33%)
CA14NP_036245.1 alpha_CA_XII_XIV 29..278 CDD:239400 88/263 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.