DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and cah-1

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001309492.1 Gene:cah-1 / 186231 WormBaseID:WBGene00000279 Length:303 Species:Caenorhabditis elegans


Alignment Length:309 Identity:86/309 - (27%)
Similarity:131/309 - (42%) Gaps:69/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLLLLPLAFYQSTNGMEWNYLKN-----------GKDWEDLCSSGKHQSPI-------LLDSRTA 55
            ::|...::..:|:...:|:|..:           .|||. :|..|:.||||       |.|:.  
 Worm    13 IILTCHISPLKSSQNYQWSYDSDVFGGPHFWGLVEKDWW-MCKKGRLQSPIDIQPDRLLFDAS-- 74

  Fly    56 RKWVLPGITFWHYYRLLKRPFYIR--NNGHSISLDIPVTSNGRKPFITGGRLKG-RYYADGLHFH 117
               |.|       .||.|.|....  |.|..:.:.|..:|......||.|.|.| ||....:.||
 Worm    75 ---VKP-------VRLDKLPVVSEFVNTGQMVRVRIGYSSKKPSVNITSGPLYGYRYRVQRIDFH 129

  Fly   118 WGSYKSRGSEHLINKRRFDAEIHIV-HRNEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPL 181
            .|.....||||.||.|||..|:.:| :..:.|.|...|.:...|:|:::::|....:.|.:   |
 Worm   130 MGRKNENGSEHTINGRRFPMEVQLVAYNTDLYPNFTSASKSPHGIAILSVLVDFGPETNQE---L 191

  Fly   182 SRLMEAVVRVPIEDSNATV--FGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTT 244
            .:|..|...:..:|....:  |....|....     ||..|||||||:|.|.||||||:..:   
 Worm   192 IKLTIATASISYKDQRVQLADFEPWRLLPFT-----RDIITYEGSLTSPGCHETVTWIILNQ--- 248

  Fly   245 VTMSSVSKFWLLRDH---WGHRLIN-----------NYRIVQDLNNRTV 279
                   ..::.::|   |.|..::           |:|.:|:.|||.|
 Worm   249 -------PIFIKKEHFEEWSHLYLSMEGAEKVPVAPNFRKIQETNNRLV 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 82/289 (28%)
cah-1NP_001309492.1 alpha_CARP_X_XI_like 39..295 CDD:239395 82/283 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.