DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and cah-3

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001370788.1 Gene:cah-3 / 181713 WormBaseID:WBGene00000281 Length:246 Species:Caenorhabditis elegans


Alignment Length:262 Identity:88/262 - (33%)
Similarity:126/262 - (48%) Gaps:30/262 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNGKDWEDLCSSGKHQSPILLD-SRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSISLDI 89
            |:|..:.:...:...:|:|||||.:| ....||....||.|.:|...::..  |.|||||:.:..
 Worm     5 WSYCDDDECGPNRWPTGQHQSPINIDLGEVERKDTHDGIKFVNYDHPIQGD--IVNNGHSVQMTP 67

  Fly    90 PVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQA 154
            .:.|  ..|.|.||.|...|.....|||||...:.||||.:...|:.||:|:||         |.
 Worm    68 ELRS--EHPEIYGGGLDQVYRLVQYHFHWGENDNEGSEHTLGGLRYPAELHLVH---------QG 121

  Fly   155 VRQKDGLAVVAIMVAIVRKDNAKSTP---LSRLM--EAVVRVPIEDSNATVFGQSSLDQLIGGVS 214
            |.....||||.:.:.:.::..|.|..   |.:|.  |.|.||    .|..:..:...::      
 Worm   122 VEDPGKLAVVGVFLQLGKEGKALSNEERVLGKLCNPETVTRV----ENVRLSEKLPANK------ 176

  Fly   215 HRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLINNYRIVQDLNNRTV 279
             |.|:.||||||||.|.|.|||.:|||..|||...:..|..::|.....:..|||..|:||:|.:
 Worm   177 -RSFWRYEGSLTTPPCSEIVTWTIFTEPVTVTHDQLELFRQVQDIEKRPIKKNYRPTQNLNDRKI 240

  Fly   280 FY 281
            .:
 Worm   241 VH 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 87/257 (34%)
cah-3NP_001370788.1 Carb_anhydrase 5..239 CDD:215000 87/257 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - mtm8413
orthoMCL 1 0.900 - - OOG6_100138
Panther 1 1.100 - - O PTHR18952
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.830

Return to query results.
Submit another query.