DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and cah-4

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_510265.1 Gene:cah-4 / 181478 WormBaseID:WBGene00000282 Length:280 Species:Caenorhabditis elegans


Alignment Length:195 Identity:57/195 - (29%)
Similarity:91/195 - (46%) Gaps:38/195 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 FITGGRLKGRYYA-DGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHRNEKYRNIAQAVRQKDGLA 162
            |:|...|....:| ...|.||||....||||.::.::...|:|.|..|..|.:...|:.:.||||
 Worm   104 FLTANHLPSSKFALAQFHAHWGSNSKEGSEHFLDGKQLSGEVHFVFWNTSYESFNVALSKPDGLA 168

  Fly   163 VVAI-------------MVAIVRKDNAKSTPLSRLMEAVVRVPIEDSNATVFGQSSLDQLIGGVS 214
            ||.:             ::..|||....:||::        :| :|.:        ::.|:....
 Worm   169 VVGVFLKEGKYNDNYHGLIDTVRKATGNATPIA--------MP-KDFH--------IEHLLPSPD 216

  Fly   215 HRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLINNYRIVQDLNNRTV 279
            .|:|.||.||||||..:|.|.|.:|||...|:...::   :||    :.:..|:|..||..:|.:
 Worm   217 KREFVTYLGSLTTPPYNECVIWTLFTEPVEVSFGQLN---VLR----NIIPANHRACQDRCDREI 274

  Fly   280  279
             Worm   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 56/192 (29%)
cah-4NP_510265.1 alpha_CA 50..275 CDD:238200 57/195 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm14370
orthoMCL 1 0.900 - - OOG6_100138
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.