DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and cah-2

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_495567.3 Gene:cah-2 / 174218 WormBaseID:WBGene00000280 Length:337 Species:Caenorhabditis elegans


Alignment Length:299 Identity:78/299 - (26%)
Similarity:121/299 - (40%) Gaps:64/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLPLAFYQSTNGMEWNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPF 76
            ||....|....|.::..|.:| ||. :|::|:.|||:.:|..                :||..|.
 Worm     5 LLTACIYPCVIGPDFWGLLHG-DWR-MCTAGQMQSPVNIDPS----------------QLLYDPH 51

  Fly    77 YIRNNGHSISLDIPVTSNGRKPFIT--------------GGRLKGRYYADGLHFHWG--SYKSRG 125
            .:..|.....::....:.|:.|.:|              |..:..||....:..|:|  ....:|
 Worm    52 LMPINIEGNIVEAVFENTGQLPVVTVKDLPNRPTINITGGPTMPYRYKLHQISVHFGRADEGEKG 116

  Fly   126 SEHLINKRRFDAEIHIVHRNEK-YRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEA-- 187
            |||.:::.||.|||.::..|.. |.|.:.|:....||..|:::|.|   ....|..|.||..|  
 Worm   117 SEHTVDRVRFPAEIQLLAYNSALYPNFSVAMTSPRGLLAVSVIVDI---GKTTSVELRRLTVASQ 178

  Fly   188 VVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSK 252
            .:....:.:|.|.|..|:   |:...||  :.|||||||.|.|.|||||::......:|...:  
 Worm   179 SINYKGQTTNLTDFQPSA---LLPKTSH--YVTYEGSLTFPGCHETVTWVILNNPIYITNDDL-- 236

  Fly   253 FWLLRDHWGHR------------LINNYRIVQDLNNRTV 279
                 ..|...            :...||.::.||.|.|
 Worm   237 -----QIWNEMQKTETKQPEPSYMTPAYRPLKSLNGRLV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 72/282 (26%)
cah-2NP_495567.3 alpha_CARP_X_XI_like 16..275 CDD:239395 75/288 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.