DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Ptprg

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_599183.2 Gene:Ptprg / 171357 RGDID:620774 Length:1442 Species:Rattus norvegicus


Alignment Length:284 Identity:80/284 - (28%)
Similarity:124/284 - (43%) Gaps:56/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNG----KDW--EDLCSSGKHQSPI-LLD--SRTARKWVLPGITFWHYYRLLKRPF----- 76
            |.|  :|    :.|  ..:...|.||||| :||  :|...:          |..|....|     
  Rat    60 WAY--SGAYGPEHWVTSSVSCGGSHQSPIDILDHHARVGEE----------YQELQLDGFDNESS 112

  Fly    77 ---YIRNNGHSISL----DIPVTSNGRKPFITGGRLKGRYYADGLHFHWG-SYKSRGSEHLINKR 133
               :::|.|.::::    |.         |::|..|.||:.|:.:.|||| |..|.||||.:|.|
  Rat   113 NKTWMKNTGKTVAILLKDDY---------FVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGR 168

  Fly   134 RFDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIEDSN 197
            ||..|:.|...| :.:.:...|:.:...:..:||...:..:||:...|:...::.||    ....
  Rat   169 RFPVEMQIFFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVV----HHEK 229

  Fly   198 ATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLL-----R 257
            .|......|..|: ..|...::.|.||||||.|.|.|.||||.....::...:..|:.:     :
  Rat   230 ETFLDPFVLRDLL-PASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQ 293

  Fly   258 DHWG--HRLINNYRIVQDLNNRTV 279
            ||..  ..|.||:|..|.||:|.|
  Rat   294 DHVKSVEYLRNNFRPQQALNDRVV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 78/281 (28%)
PtprgNP_599183.2 alpha_CARP_receptor_like 67..319 CDD:239396 77/275 (28%)
FN3 348..438 CDD:238020
R-PTPc-G-1 845..1118 CDD:350505
R-PTP-G-2 1202..1406 CDD:350508
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.