DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Car11

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_006540651.1 Gene:Car11 / 12348 MGIID:1336193 Length:344 Species:Mus musculus


Alignment Length:292 Identity:81/292 - (27%)
Similarity:123/292 - (42%) Gaps:65/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKN---------------GKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRP 75
            |:|.:|               ...| .||:.||.|||:.::.:                |:|..|
Mouse    35 WSYKENLQGNFVPGPPFWGLVNAAW-SLCAVGKRQSPVDVELK----------------RVLYDP 82

  Fly    76 FY---------------IRNNGHSISLDIPVTSNGRKPF--ITGGRLKGRYYADGLHFHWGSYKS 123
            |.               :.|.|..:|. :|.:    :|.  ::||.|...:....|...:|:...
Mouse    83 FLPPLRLSTGGEKLRGTLYNTGRHVSF-LPAS----RPVVNVSGGPLLYSHRLSELRLLFGARDG 142

  Fly   124 RGSEHLINKRRFDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTP-LSRLME 186
            .||||.||...|.||:.::|.| |.|.|::.|.|..:|||::::.|.:.    ..|.| ||||:.
Mouse   143 AGSEHQINHEGFSAEVQLIHFNQELYGNLSAASRGPNGLAILSLFVNVA----GSSNPFLSRLLN 203

  Fly   187 AVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVS 251
            ......|...|...|.|....:|:...|. .|.||:|||:||.|.||||||:......:|...:.
Mouse   204 RDTITRISYKNDAYFLQDLSLELLFPESF-GFITYQGSLSTPPCSETVTWILIDRALNITSLQMH 267

  Fly   252 KFWLLRDHWGHR----LINNYRIVQDLNNRTV 279
            ...||..:...:    |..|.|.:|.|.:|.:
Mouse   268 SLRLLSQNPPSQIFQSLSGNGRPLQPLAHRAL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 80/289 (28%)
Car11XP_006540651.1 alpha_CARP_X_XI_like 48..304 CDD:239395 78/279 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835729
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4838
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.