DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca12

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_009296363.1 Gene:ca12 / 100537787 ZFINID:ZDB-GENE-080815-4 Length:505 Species:Danio rerio


Alignment Length:302 Identity:98/302 - (32%)
Similarity:139/302 - (46%) Gaps:50/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KLLLLLPLAFYQSTNGMEWNYLKNGKDWE-------DLCSSGKHQSPILLDSRTAR-KWVLPGIT 64
            |::|::.:|...:..|.:|.|  ||.|.|       ..| .|..||||...:...| ...||.|.
Zfish     4 KIILIILIACPLALTGRKWTY--NGLDGEHDWPTNYPFC-GGAFQSPIDFQTHLLRYDPNLPPIQ 65

  Fly    65 FWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYK-SRGSEH 128
            ..:|.........:.|||||:.|.:|     ...:|:.  |..||.|..|||||||.. ..||||
Zfish    66 VQNYNLSTSEQLTLGNNGHSVQLSLP-----SHMYISS--LPHRYSAAQLHFHWGSSNLLTGSEH 123

  Fly   129 LINKRRFDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAV---- 188
            .:|.::|..|:|:||.| :||.|::.||.:.|||||:.:.:.| .:.|.....|.|.:..|    
Zfish   124 TVNGKQFAGEMHVVHFNSDKYPNVSMAVDKHDGLAVLGVFIEI-GEANPAFDKLFRFISGVKYRD 187

  Fly   189 --VRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVS 251
              ::||..:..|.:  ...|||         ::.|:||||||.|..:|.|.||.:..|:   |..
Zfish   188 QKIQVPAFNIRALL--PDRLDQ---------YYRYDGSLTTPPCYPSVLWTVFRKPVTI---SRK 238

  Fly   252 KFWLL---------RDHWGHRLINNYRIVQDLNNRTVFYKKR 284
            :|..|         :|.....|..|||..|..:||.|....|
Zfish   239 QFLALATALYASFAQDSPSMPLHENYRKSQLPDNRVVLVSFR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 91/276 (33%)
ca12XP_009296363.1 alpha_CA 29..279 CDD:294017 88/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.