DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca3

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_002939197.2 Gene:ca3 / 100496328 XenbaseID:XB-GENE-1007186 Length:262 Species:Xenopus tropicalis


Alignment Length:270 Identity:84/270 - (31%)
Similarity:132/270 - (48%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EWNYLK-NGKD-WEDL--CSSGKHQSPILLDSR------TARKWVLPGITFWHYYRLLKRPFYIR 79
            :|.|.. ||.| |.:.  .:.|..||||.|.:|      |.|.|.    :.:|....|.    :.
 Frog     6 DWGYASHNGPDTWAEYFPAAKGDQQSPIELLTRYIKHDPTLRPWT----STYHPSTSLT----VV 62

  Fly    80 NNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIVHR 144
            |:|.:..:....:::  |..|..|.:.|.|....|.|||||....||||:|:..|:..|:|.:|.
 Frog    63 NDGTTCRVVFDDSTD--KSVIKDGPMNGTYRLRQLQFHWGSSDDHGSEHVIDGFRYAGEMHFIHW 125

  Fly   145 NEKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTP-LSRLMEAVVRVPIEDSNATVFGQSSLDQ 208
            |.||.||.:|.:..||:|::|:.:.|     .|:.| |..::||:..:..:...|..   :..|.
 Frog   126 NSKYDNITEAKKHPDGVAIIAVFLKI-----GKAKPHLKLVLEALDCIKNKGKKAHF---TDFDP 182

  Fly   209 LIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKF----WLLRDHWGHRLINNYR 269
            .|...|.||::||:||.|||.|:|.|||::.:|..||:...:.||    ..|.......:::|:|
 Frog   183 TILFPSSRDYWTYQGSFTTPPCEECVTWLLLSEPITVSPEQMEKFRSVYSTLEGEIECHMVDNFR 247

  Fly   270 IVQDLNNRTV 279
            ..|.:..|.:
 Frog   248 PPQPVKGREI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 83/266 (31%)
ca3XP_002939197.2 alpha_CA 4..261 CDD:412109 84/270 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48615
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.