DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca11

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_002938168.2 Gene:ca11 / 100493884 XenbaseID:XB-GENE-6037596 Length:330 Species:Xenopus tropicalis


Alignment Length:291 Identity:82/291 - (28%)
Similarity:131/291 - (45%) Gaps:72/291 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AFYQSTNGMEWNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFY--- 77
            ||:...|. .||          ||:.||.||||.:::.                :::..||.   
 Frog    49 AFWGLVNS-AWN----------LCTIGKRQSPININTS----------------QIIFDPFLPPL 86

  Fly    78 ------------IRNNGHSISLDI----PVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGS 126
                        :.|.|..:|..:    ||.       |:||.|...:..:.:..|:||..|.||
 Frog    87 RLSMTGTTVSGTMHNTGRHVSFRLDKEQPVN-------ISGGPLLYNHRLEEVMLHFGSENSIGS 144

  Fly   127 EHLINKRRFDAEIHIVHRNEK-YRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLM--EAV 188
            |||:||.....|:.::|.|:. |.|:.:|.|..:||||:::.:.:.  ||:.|. |:|::  |.:
 Frog   145 EHLMNKETSAGEVQLIHYNQDLYSNVTEASRNPNGLAVISLFLNVA--DNSNSF-LNRMLNRETI 206

  Fly   189 VRVPIEDSNATVFGQSSLDQLIGGVSHRD---FFTYEGSLTTPLCDETVTWIVFTETTTVTMSSV 250
            .|:... :.||.....|::.|     :.|   |.||:||:|.|.|.|||||||......:|...:
 Frog   207 TRISFR-NEATYIQDLSIEDL-----YPDTFGFLTYQGSMTIPPCYETVTWIVIDRPLNITSMQM 265

  Fly   251 SKFWLLRDHWGHRLI----NNYRIVQDLNNR 277
            ....||..:...::.    :|:|.||.|.:|
 Frog   266 HSLRLLSQNQPSQIFQSMSDNFRPVQPLFHR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 79/281 (28%)
ca11XP_002938168.2 alpha_CARP_X_XI_like 47..303 CDD:239395 82/291 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.