DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca10

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_031750638.1 Gene:ca10 / 100493207 XenbaseID:XB-GENE-949649 Length:328 Species:Xenopus tropicalis


Alignment Length:274 Identity:73/274 - (26%)
Similarity:129/274 - (47%) Gaps:46/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSIS---- 86
            |..:.:.  | :||:.||.|||:.::  |:.....|.:|          |..|...|..:|    
 Frog    50 WGLVNSA--W-NLCAVGKRQSPVNIE--TSHMIFDPFLT----------PLRINTGGRKVSGTMY 99

  Fly    87 ---------LDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIV 142
                     ||.....|     |:||.|...:..:.:..|:||...:|||||:|.:.|..|:.::
 Frog   100 NTGRHVSLRLDKEHLVN-----ISGGPLTYSHRLEEIRLHFGSEDGQGSEHLLNGQAFSGEVQLI 159

  Fly   143 HRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLM--EAVVRVPIEDSNATVFGQS 204
            |.| |.|.|:..|.:..:||.|::|.:.:....|..   |:|::  :.:.|:..: ::|.:....
 Frog   160 HYNHELYTNVTDAAKSPNGLVVISIFIKVTDSSNLF---LNRMLNRDTITRITYK-NDAYLLQGL 220

  Fly   205 SLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLI---- 265
            :::::....|  .|.||:||:|.|.|.||.:||:..:...:|...:....||..:...::.    
 Frog   221 NIEEIYPETS--SFITYDGSMTIPPCYETASWIIMNKPIYITRMQMHSLRLLSQNQPSQIFSSMS 283

  Fly   266 NNYRIVQDLNNRTV 279
            :|:|.||.||||.:
 Frog   284 DNFRPVQSLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 72/271 (27%)
ca10XP_031750638.1 alpha_CARP_X_XI_like 46..302 CDD:239395 73/274 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.