DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and Car10

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_017453181.1 Gene:Car10 / 100360015 RGDID:2322930 Length:328 Species:Rattus norvegicus


Alignment Length:275 Identity:78/275 - (28%)
Similarity:133/275 - (48%) Gaps:48/275 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 WNYLKNGKDWEDLCSSGKHQSPILLDSRTARKWVLPGITFWHYYRLLKRPFYIRNNGHSIS---- 86
            |..:.:.  | :|||.||.|||:.::  |:.....|.:|          |..|...|..:|    
  Rat    50 WGLVNSA--W-NLCSVGKRQSPVNIE--TSHMIFDPFLT----------PLRINTGGRKVSGTMY 99

  Fly    87 ---------LDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGSYKSRGSEHLINKRRFDAEIHIV 142
                     ||.....|     |:||.:...:..:.:..|:||..|:|||||:|.:.|..|:.::
  Rat   100 NTGRHVSLRLDKEHLVN-----ISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLI 159

  Fly   143 HRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTP-LSRLM--EAVVRVPIEDSNATVFGQ 203
            |.| |.|.|:.:|.:..:||.||:|.:    |.:..|.| |:|::  :.:.|:..: ::|.:...
  Rat   160 HYNHELYTNVTEAAKSPNGLVVVSIFI----KVSDSSNPFLNRMLNRDTITRITYK-NDAYLLQG 219

  Fly   204 SSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVSKFWLLRDHWGHRLI--- 265
            .::::|....|  .|.||:||:|.|.|.||.:||:..:...:|...:....||..:...::.   
  Rat   220 LNIEELYPETS--SFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSM 282

  Fly   266 -NNYRIVQDLNNRTV 279
             :|:|.||.||||.:
  Rat   283 SDNFRPVQPLNNRCI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 77/272 (28%)
Car10XP_017453181.1 alpha_CARP_X_XI_like 46..302 CDD:239395 78/275 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.