DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca14

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:NP_001103521.1 Gene:ca14 / 100126213 XenbaseID:XB-GENE-855636 Length:343 Species:Xenopus tropicalis


Alignment Length:295 Identity:94/295 - (31%)
Similarity:138/295 - (46%) Gaps:48/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LLLLPLAFYQSTNGMEWNYL-KNGKD-WEDL---CSSGKHQSPI-LLDSRTARKWVLPGITFWHY 68
            ||:|.:: :.:..|.||.|. .:|:: |...   | .|..|||| :..|..:....||.|....|
 Frog     6 LLILSIS-HVTVRGSEWTYAGHHGQENWPVTYPDC-GGTAQSPINIQTSNISYDESLPPIEPEGY 68

  Fly    69 YRLLKRPFYIRNNGHSISLDIP--VTSNGRKPFITGGRLKGRYYADGLHFHWGS-YKSRGSEHLI 130
            .....:||.:.|||||:.|.:|  :|..|         |...:.|..||.|||| .|..||||.:
 Frog    69 NTPGNQPFTLTNNGHSVELSLPSSMTLRG---------LPNTFKAAQLHLHWGSPAKQAGSEHRL 124

  Fly   131 NKRRFDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLSRLMEAVVRVPIE 194
            :...|.||:||||.| :||.:|::|..:.|||||:.:...|...||   ...:.::..:..:..:
 Frog   125 DGEEFPAELHIVHYNSDKYADISEAKNKPDGLAVLGVFFEIGATDN---PAYANILHHLDNIRYK 186

  Fly   195 DSNATV--FGQSSLDQLIGGVSH------RDFFTYEGSLTTPLCDETVTWIVFTETTTVTMSSVS 251
            |...:|  |          .|.|      .::|.|:||||||.|.::|.|.||.....::.|.:.
 Frog   187 DQTVSVPSF----------NVRHLLPENLEEYFRYQGSLTTPPCYQSVLWTVFYHPVEISRSQLE 241

  Fly   252 KF------WLLRDHWGHRLINNYRIVQDLNNRTVF 280
            |.      ....:.....|.||.|..|.||:|||:
 Frog   242 KLQTTLYSTTATEVPPEVLGNNVREAQLLNSRTVY 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 86/275 (31%)
ca14NP_001103521.1 alpha_CA 28..279 CDD:294017 87/272 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4459
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 1 1.000 - - otm47532
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.060

Return to query results.
Submit another query.