DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CAH16 and ca6

DIOPT Version :9

Sequence 1:NP_001287620.1 Gene:CAH16 / 50101 FlyBaseID:FBgn0040628 Length:286 Species:Drosophila melanogaster
Sequence 2:XP_009295179.1 Gene:ca6 / 100006448 ZFINID:ZDB-GENE-030131-7091 Length:538 Species:Danio rerio


Alignment Length:293 Identity:94/293 - (32%)
Similarity:140/293 - (47%) Gaps:44/293 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLLPLAFYQSTN-------GMEWNYLKNG----KDWEDL---CSSGKHQSPILLDSRTAR----- 56
            |.|.|.|..|.|       |..|.|  :|    |.|.:.   | .|:.||||.:..|..|     
Zfish     4 LTLVLLFVTSLNFASAGVDGDYWTY--SGELDQKHWAEKYHDC-GGQQQSPIDIQRRKVRYSPRM 65

  Fly    57 -KWVLPGITFWHYYRLLKRPFYIRNNGHSISLDIPVTSNGRKPFITGGRLKGRYYADGLHFHWGS 120
             :..|.|      |..::..|.::|||||:.:.:|.|....|.|      ..:|.|..:|.|||.
Zfish    66 QQLELTG------YEDIRGSFLMKNNGHSVEIQLPSTMKITKGF------PHQYTAVQMHLHWGG 118

  Fly   121 Y--KSRGSEHLINKRRFDAEIHIVHRN-EKYRNIAQAVRQKDGLAVVAIMVAIVRKDNAKSTPLS 182
            :  ::.||||.::..|:.||:|:||.| |||.:..:|..:.|||||:|.   .....:.::|..|
Zfish   119 WDLEASGSEHTMDGIRYMAELHVVHYNSEKYPSFEEAKNKPDGLAVLAF---FFEDGHFENTYYS 180

  Fly   183 RLMEAVVRVPIEDSNATVFGQSSLDQLIGGVSHRDFFTYEGSLTTPLCDETVTWIVFTETTTVTM 247
            ..:..:..:.....:.::...:.|..|...:||  |:.|:||||||.|.|:|.|.||....|::.
Zfish   181 DFISNLANIKYVGQSMSISNLNVLSMLSENLSH--FYRYKGSLTTPPCFESVMWTVFDTPITLSH 243

  Fly   248 SSVSKF-WLLRDHWGHRLINNYRIVQDLNNRTV 279
            :.:.|. ..|.||....|.|:||:.|.||.|.|
Zfish   244 NQIRKLESTLMDHDNKTLWNDYRMAQPLNERVV 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CAH16NP_001287620.1 Carb_anhydrase 26..278 CDD:215000 85/268 (32%)
ca6XP_009295179.1 alpha_CA 33..281 CDD:320708 84/262 (32%)
LamG 332..521 CDD:328935
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579100
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG3338
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1377476at2759
OrthoFinder 1 1.000 - - FOG0000047
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X57
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.