DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase12 and SPC1

DIOPT Version :9

Sequence 1:NP_788760.1 Gene:Spase12 / 50096 FlyBaseID:FBgn0040623 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_012544.1 Gene:SPC1 / 853467 SGDID:S000003770 Length:94 Species:Saccharomyces cerevisiae


Alignment Length:81 Identity:22/81 - (27%)
Similarity:39/81 - (48%) Gaps:10/81 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DIQTHM----DFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQ---TVYILGAGFVLSSLITI 60
            |:|..:    ||..|.|.|::.:..:....:|..:.| |.||..:   |.|  |...|::.:..:
Yeast     7 DVQRKLVFPIDFPSQRKTEKFQQLSLMIGALVACILG-FAQQSLKVLLTAY--GISCVITLICVL 68

  Fly    61 PPWPLYRRNALKWQKP 76
            |.:|.|.:..|:|.:|
Yeast    69 PAYPWYNKQKLRWAQP 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase12NP_788760.1 SPC12 8..76 CDD:369018 19/74 (26%)
SPC1NP_012544.1 SPC12 16..85 CDD:399559 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4112
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003957
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103297
Panther 1 1.100 - - LDO PTHR13202
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.