DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spase12 and Spcs1

DIOPT Version :9

Sequence 1:NP_788760.1 Gene:Spase12 / 50096 FlyBaseID:FBgn0040623 Length:98 Species:Drosophila melanogaster
Sequence 2:NP_081187.2 Gene:Spcs1 / 69019 MGIID:1916269 Length:161 Species:Mus musculus


Alignment Length:92 Identity:43/92 - (46%)
Similarity:58/92 - (63%) Gaps:2/92 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IQTHMDFAGQGKAERWSRFIITFFGIVGLVYGAFVQQFSQTVYILGAGFVLSSLITIPPWPLYRR 68
            :.|.||:.||..||:..:.||.|..|||.:||...:||..||||:.|||..|.|:|:||||:|||
Mouse    67 LPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLLTLPPWPIYRR 131

  Fly    69 NALKWQKPIDTDAKSSSSESGDEGKKK 95
            :.||| .|:. |..:...:|||...|:
Mouse   132 HPLKW-LPVQ-DLGTEDKKSGDRKIKR 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spase12NP_788760.1 SPC12 8..76 CDD:369018 36/67 (54%)
Spcs1NP_081187.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
SPC12 71..140 CDD:284140 37/69 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849957
Domainoid 1 1.000 80 1.000 Domainoid score I8624
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 84 1.000 Inparanoid score I5161
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003957
OrthoInspector 1 1.000 - - oto92576
orthoMCL 1 0.900 - - OOG6_103297
Panther 1 1.100 - - LDO PTHR13202
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2808
SonicParanoid 1 1.000 - - X3839
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.920

Return to query results.
Submit another query.